Нажмите "Enter", чтобы перейти к контенту

Влияние диабетических ассоциированных аутоантигенов на клеточные процессы в РВМС человека и их значимость для развития аутоиммунного диабета

The Effect of Diabetes-Associated Autoantigens on Cell Processes in Human PBMCs and Their Relevance to Autoimmune Diabetes Development
Источник: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3694381/

академический редактор: J Ian ξ 奥

Диабет типа 1 (T1D) считается аутоиммунным заболеванием Т-хелпер- (Th-) 1; однако патогенез T1D, вероятно, включает в себя множество факторов, и в настоящее время недостаточно средств для выявления аутореактивных Т-клеток для изучения этого заболевания. В этом исследовании, используя микроматрицы экспрессии генов, мы проанализировали влияние связанных с диабетом аутоантигенов на мононуклеарные клетки периферической крови (РВМС) с целью выявления (до) связанных с диабетом клеточных процессов. Были опробованы 12 пациентов с недавним началом T1D, 18 родственников первой степени пациентов TD1 (DRL, 9/18 аутоантитела положительный) и 13 здоровых контролей (DV). РВМС от этих индивидуумов стимулировали коктейлем связанных с диабетом аутоантигенов (проинсулин, IA-2 и GAD65-производных пептидов). Через 72 часа экспрессию гена оценивали микрочипом гена высокой плотности. Наибольшее количество функциональных различий наблюдалось между родственниками и контрольной группой (69 путей), из которых 15% путей принадлежали к процессам, связанным с иммунным ответом. В сравнении с контролем T1D и контроле более широкие пути (24%) были классифицированы как «связанные с иммунным ответом». Важными путями, которые были идентифицированы с использованием данных сравнения T1D и контролей, были пути, включающие представление антигена MHCII, активацию Th17 и Th22 ответы и процессы, связанные с перестройкой цитоскелета. Гены, участвующие в каскадах Th17 и TGF-бета, могут представлять собой новые перспективные (до) диабетические биомаркеры.

Диабет типа 1 (T1D) считается аутоиммунным заболеванием Т-хелпера (Th-) 1 и характеризуется отсутствием инсулина, который вызван аутоиммунным разрушением инсулин-продуцирующих панкреатических бета-клеток [1,2] , Th1-лимфоциты ответственны за инфильтрацию островков Лангерганса и высвобождение цитокинов, что облегчает разрушение бета-клеток цитотоксическими (Tc) лимфоцитами. Из-за этого прогрессирующего повреждения имеется либо недостаточное количество, либо отсутствует производство инсулина, что приводит к первым клиническим признакам T1D. При первом появлении клинических симптомов, в первую очередь связанных с гипергликемией, почти 80% бета-клеток были уничтожены, что делает человека зависимым от инъекций инсулина [2, 3].

У пациентов с недавним началом T1D существуют различные вмешательства, которые могут остановить или, по крайней мере, задержать разрушение бета-клеток поджелудочной железы; однако эти методы лечения неспособны обратить вспять зависимость жизни пациента от инсулиновых инъекций, поскольку пролиферация бета-клеток и их способность к регенерации ограничены. Чтобы сохранить достаточную массу бета-клеток, эти методы лечения следует использовать в клинически бесшумной фазе предварительного диабета; однако трудно идентифицировать подходящих кандидатов для такого иммуноферментного вмешательства [4-6].

Доклинический период отмечен наличием аутоантител против бета-клеточных антигенов, включая инсулин, декарбоксилазу глутаминовой кислоты-65 (GAD65), инсулинома-ассоциированную тирозинфосфатазу (IA-2) и цинковый транспортер 8 (ZnT8). Наличие этих аутоантител в сыворотке является высокопрогнозирующим развитием T1D [7-9]. Однако наличие аутоантител в одиночку недостаточно для индукции разрушения бета-клеток [10-13].

Доклиническая стадия заболевания характеризуется генерацией активированных, самореактивных лимфоцитов, которые проникают в поджелудочную железу и избирательно разрушают инсулин-продуцирующие бета-клетки, присутствующие в островках [14]. Кроме того, в патогенезе T1D участвуют другие клеточные иммунные механизмы, включая иммунорегуляцию и представление и обработку антигена. В других исследованиях выявлена ​​значимость отказа регуляторных механизмов, которые в основном включают регуляторные Т-клетки, которые подавляют пролиферацию и продуцирование цитокинов как CD4 +, так и CD8 + Т-клетками in vitro при контакте с клетками, а также секрецию противовоспалительных цитокины (например, интерлейкин- (IL-) 10 и трансформирующий фактор роста (TGF-) бета) [15]. Взятые вместе, патогенез T1D очень сложный, и все аспекты этого заболевания не полностью поняты. Хотя обнаружение аутоантител очень полезно при изучении этого заболевания, этого метода недостаточно для идентификации преддиабетического человека.

Автореактивные Т-лимфоциты присутствуют в периферической крови на чрезвычайно низких частотах, и методы их обнаружения все еще используются для научных, а не клинических целей [10, 13].

В последнее десятилетие начался бум «методов массива», который позволяет проводить комплексный анализ экспрессии генов или производства белка. Эти методы также использовались в исследованиях T1D для улучшения прогнозирования T1D и повышения общего знания о патогенезе T1D [16, 17].

В этой статье мы сообщаем об идентификации клеточных процессов, которые могут иметь важное значение для прогрессирования диабета до диабета. Мы выделили мононуклеарные клетки периферической крови (РВМС) и затем стимулировали эти клетки смесью «аутоантигенов, связанных с T1D». Мы сравнили профили экспрессии стимулированных РВМС и РВМС, культивируемые в течение того же периода в отсутствие аутоантигенов для определения влияния аутоантигенов на экспрессию генов. Мы описываем на уровне экспрессии генов различия в иммунных ответах среди тестируемых групп, которые, как прогнозируется, являются важными в патогенезе T1D. Гены, участвующие в этих каскадах или в активации этих каскадов, могут служить перспективными потенциальными биомаркеры преддиабета. В наших анализах мы в основном сосредоточивались на функциональных путях и пытались выявить различия в экспрессии генов среди множества сигнальных путей, в которых действуют эти гены.

Исследовательская популяция описана в таблице 1. Сыворотки от всех родственников были исследованы с помощью радиоиммунного анализа в рамках национальной программы прогнозирования T1D (RIA, Solupharm, Brno, Czech Republic) для присутствия аутоантител против островковых антигенов GAD65, IA-2 и инсулина. Образец считался положительным, если для GAD65 (GADA) и IA-2 (IA-2A) (> 99th pct.) Было> ​​1 МЕ / мл. Для аутоантител к инсулину (ИАА) обрезание составляло 0,4 Ед / мл. Аутоантител был успешно оценен DASP 2010 (программа стандартизации диабетической аутоантител иммунологии диабетического общества). Тип позитивности аутоантител в сыворотке пациентов и родственников указан в дополнительной таблице 1, доступной в Интернете по адресу: http://dx.doi.org/10.1155/2013/589451. Сыворотки от здоровых добровольцев были аутоантител отрицательными.

Отбор проб пациентов с недавним началом T1D проводился после фазы метаболической стабилизации на седьмой день после диагноза диагноз в утренние часы. Метаболическая стабилизация определяется как установление нормогликемии и нормализация кислотно-щелочного баланса, биохимических параметров (таких как ионы и рН) и параметров количества крови. Пациенты с тяжелым диабетическим кетоацидозом (рН ≤ 7,1) во время диагноза болезни были исключены из исследования. Этическое одобрение, а также форма информированного согласия, обязательная для всех участников этого исследования, были обработаны Этическим комитетом университетской больницы Motol в отношении общих национальных правил и правил ЕС. На основе информированного согласия пациента были взяты пробы крови, выделение и анализ нуклеиновых кислот и анонимная обработка данных.

Из испытуемых было получено приблизительно 17 мл периферической крови. РВМС были выделены из цельной венозной крови центрифугированием градиента плотности Ficoll (Amersham Biosciences, Uppsala, Sweden) и использовались во всех экспериментах in vitro. Недавно выделенные PMBC (4 × 106 клеток) ресуспендировали в 2 мл среды RPMI-1640 (Invitrogen, Carlsbad, CA, USA), дополненной 20% фетальной телячьей сывороткой (FCS-F7524, Sigma-Aldrich, St. Louis, USA ) и 10 мкл / мл раствора Sigma, который содержит 200 мкМ L-глутамина, 100 мкг пенициллина и 100 мкг / мл стрептомицина (G1146, Sigma-Aldrich, Сент-Луис, США) и культивировали в течение 72 часов в отсутствие или наличие смеси следующих аутоантигенных пептидов (ProImmune, Oxford, UK): аминокислоты GAD65 (aa) 247-279 (NMYAMMIARFKMFPEVKEKGMAALPRLIAFTSEE-OH), молекулярная масса 3 823,7; зенитный 509-528 (IPPSLRTLEDNERMSRLSK-OH), молекулярная масса 2 371,7; зенитный 524-543 (SRLSKVAPVIKARMMEYGTT-OH), молекулярная масса 2,238,7; IA-2 a.a. 853-872 (SFYLK (Nleu) VQTQETRTLTQFHF), молекулярная масса 2,489; и a.a. 9-23 β проинсулина (SHLVEALYLVCGERG), молекулярная масса 1,645 при концентрации 2 мкг / мл на 2 * 106 PBMC для всех аутоантигенных пептидов. Длина и количество экспозиции антигена были оптимизированы в лаборатории (данные не показаны).

Полную РНК из культивируемых клеток экстрагировали с использованием реагента TRIzol и набора RiboPure (Invitrogen, Carlsbad, CA, USA), растворяли в 60 мкл воды без нуклеазы и хранили при -80 ° C. Концентрацию РНК измеряли с использованием спектрофотометра (Helios γ, Thermo Fisher Scientific, Waltham, MA, USA), а целостность РНК оценивали с использованием биоанализатора Agilent 2100 (Agilent, Palo Alto, CA, USA). Для получения достаточного количества РНК для анализов с помощью микроматрицы общую РНК амплифицировали (aRNA) с использованием набора амплификации Amino Allyl MessageAmp II aRNA (Applied Biosystems / Ambion, Foster City, CA, USA). Процедура амплификации включала включение 5- (3-аминоаллил) -UTP (aaUTP) в аРНК во время транскрипции in vitro, чтобы обеспечить связывание РНК с N-гидроксисукцинимидиловым эфиром реакционноспособных Cy-красителей. Двадцать пять микрограммов aRNA были помечены Cy3 или Cy5-красителем. Красители Cy3 и Cy5 использовали для маркировки РНК, полученной из нестимулированных и аутоантигенных клеток. В соответствии с протоколом изготовителя от 3 до 6 мкг меченной аРНК гибридизовали с чипом (двухцветные экспериментальные настройки). Образцы затем обрабатывали с использованием гена HA-генома человеческого генома с высокой плотностью (Phalanx Biotech, Palo Alto, CA, USA), который содержит 32 050 зондов с 30 968 человеческими целями генома и 1082 экспериментальных контрольных зондов. Слайды сканировались с использованием InnoScan 700 (Innopsys, Carbonne, France) с разрешением 5 мкм. Артефакты были замаскированы, а исходные данные были извлечены с использованием Mapix (Innopsys, Carbonne, France).

Обработка данных микроматрицы и статистический анализ экспрессии дифференциального гена проводили с использованием пакета limma в статистической среде R (http://bioinf.wehi.edu.au/limma/), а анализ пути проводили с MetaCore (GeneGo, Inc ., St. Joseph, MI, USA; http://www.genego.com/). Двухцветная обработка данных микрочипов была выполнена в соответствии с рекомендациями производителя массива. Для каждого чипа исходные данные интенсивности были скорректированы для фона, нормализованы нормализацией лёсса внутри массива и подвергнуты последующей нормализации количественного квантиля. Дифференциальную экспрессию гена тестировали с использованием байесовского модерированного t-теста в пакете limma.

Мы исследовали различия в экспрессии генов и затронули клеточные пути между всеми комбинациями трех групп: нормальным контролем, диабетическими пациентами и их родственниками, которые были разделены в соответствии с их статусами аутоантител. Мы сравнили экспрессию базального гена с экспрессией гена после стимуляции диабетогенными аутоантигенами. Гены верхней таблицы в соответствии с анализом лиммы (значение Р ≤ 0,05) были проанализированы MetaCore для изучения функциональных соотношений между верхними генами (те гены с наиболее значимыми значениями Р). Мы сосредоточились на выявлении различий между проверенными парами исследовательских групп.

MetaCore — это собственная, созданная вручную база данных, которая анализирует белок-белок, белок-ДНК и белок-соединение человека, метаболические и сигнальные пути, а также эффекты биоактивных молекул. Это программное обеспечение создает интерактивные сети между входами пользователя и белками и / или генами, хранящимися в базе данных. Программное обеспечение позволяет пользователю анализировать распределение канонических путей, сетей, процессов GeneGo и Gene Ontology, а также актуальность биомаркеров болезни в тестируемых образцах. Канонические карты путей представляют собой набор из примерно 2000 сигнальных и метаболических карт, всесторонне охватывающих биологию человека. Содержание примерно 110 клеточных и молекулярных процессов было определено и аннотировано как процессы GeneGo, и каждый процесс представляет собой заданную сеть взаимодействий, характерную для процесса. В этой базе данных также содержится более 500 заболеваний человека с содержанием генов, аннотированных GeneGo и организованных в конкретных для болезни папках, которые далее организованы в иерархическое дерево (http://www.genego.com/). Нас интересовал общий анализ обогащения и вовлечение отдельных генов в иммунные процессы, для которых данные были отфильтрованы в MetaCore Biomarker Assessment Workflow.

qRT-PCR использовалась для проверки данных микрочипов. Были оценены различия в уровнях экспрессии CD4, преобразователя сигналов и активатора транскрипции 3 (STAT3) и TGF-бета 1 между образцами РНК из PMBC, собранных из независимой когорты T1D и контролей. В частности, экспрессия была проанализирована в когорте из 14 вновь диагностированных пациентов с T1D (7M / 7F, средний возраст 8,6 лет, медиана 9,1, диапазон 1,7-17,2 лет) и 12 контрольных добровольцев (5 M / 7F, средний возраст 10,7 лет, медиана 11,2, диапазон 2,1-18,7 лет) с использованием анализов экспрессии гена TaqMan (Lifetechnologies, Carlsbad, CA, USA). Общая РНК была экстрагирована с использованием реагента TRIzol в соответствии с рекомендациями производителя (Lifetechnologies, Carlsbad, CA, USA). кДНК была синтезирована в соответствии с рекомендациями Lifetechnologies с использованием высокомощного РНК-кДНК Master Mix (Lifetechnologies, Carlsbad, CA, USA). Эксперименты анализировали с использованием системы PCR в реальном времени LightCycler 480 (Roche, Basel, Switzerland). Для количественного определения относительных уровней мРНК использовался сравнительный порог ΔΔ цикла (Ct). Экспрессия CD4 с использованием коммерчески доступных праймеров (кат. № Hs01058407_m1), STAT3 (номер кат. Hs00427259_m1) и TGF-бета (номер кат. Hs00171257_m1) была нормирована на бета-глюкуронидазу (GUSB, номер кат. Hs99999908_m1 ).

Данные из qRT-PCR анализировали с использованием программы R. Для статистического анализа использовался непарный двухсторонний t-критерий Стьюдента. Различия с значением Р ≤ 0,05 считались значимыми.

В таблице 2 суммируется количество генов, идентифицированных как имеющие разные уровни экспрессии, когда различные тестовые группы подвергались сопоставлениям пары групп. При сравнении пациентов с T1D и контрольной группой статистически значимые различия присутствовали в экспрессии 1318 генов. 20 генов, которые продемонстрировали наибольшие изменения в экспрессии генов (up-or downregulated), перечислены в дополнительной таблице 2s. Интересно, что одним из наиболее достоверно усиленных генов у пациентов с T1D был CD4, критический Lck-связывающий корецептор, необходимый для эффективной активации CD4 + T-клеток [18]. Используя qRT-PCR, дифференциальная экспрессия CD4 была подтверждена в отдельной когорте новообразованных пациентов с T1D и здоровым контролем (рис. 1). Кроме того, TGF-бета и STAT3, представители сигналов дифференцировки клеток Th17 (которые оценили как второй наиболее существенно изменившийся иммунный путь у пациентов с T1D по сравнению с здоровыми контрольными группами), также подтвердили, что они достоверно (P <0,05) Рисунок 1).

Интересно отметить, что наибольшее количество дифференциально экспрессированных генов (2,222; P значение ≤ 0,05) было обнаружено у родственников пациентов TD1 и пациентов. Список выявленных 20-ти верхних и нижних регулируемых генов можно найти в дополнительной таблице 2. Кроме того, родственники имели значительные изменения в экспрессии 1 347 генов по сравнению с контролем (дополнительная таблица 2s). Однако мы не смогли найти каких-либо дополнительных существенных различий в экспрессии генов, когда родственники были разделены в соответствии с статусом аутоантител в DRLP (аутоантител положительный) и DRLN (аутоантитела / отрицательные) группы.

Усовершенствованная тепловая карта экспрессии гена была построена с использованием интенсивностей зондовых сигналов, которые имели изменение логарифмической шкалы, которая была больше +1 или меньше -1 (рисунок 2).

10 лучших канонических путей, которые наиболее существенно изменились при сравнении по парам, перечислены в таблице 3 (а) (резюме), а в таблице 3 (б) показан полный список значимых путей иммунного ответа, идентифицированных для каждого парного сравнения.

Наибольшее количество различий для измененных путей, в частности 69 путей, наблюдалось, когда родственников сравнивали с контролем. Из этих путей 15% принадлежали «пути иммунного ответа». Однако самый высокий процент (24%) значимых различий в пути, связанных с иммунным ответом, наблюдался, когда пациентов с Т1D сравнивали с здоровыми контрольными (11 из 46 путей) , причем «Презентация Antigen MHCII» является самым высоким показателем. Важной переменной, по-видимому, была активация Th17 лимфоцитов, поскольку мы наблюдали разницу в «дифференцировке клеток Th17» среди групп. В частности, различия в поляризации Th17 наблюдались, когда родственников сравнивали с пациентами. Путь дифференцировки клеток Th17 показан на рисунке 3. Кроме того, сравнивая пациентов с T1D с контрольной группой, мы наблюдали отчетливую активацию важных иммунных путей, участвующих в специфических иммунных реакциях, таких как поляризация Th1 / Th2, образование иммунологических синапсов , и сигнализацию через рецептор Т-клеток (таблица 3 (b)).

Иммунологическая отзывчивость у родственников была сходна с реактивностью, наблюдаемой у пациентов с T1D. Однако только 7% дифференцированных активированных путей могут быть классифицированы как «связанные с иммунным ответом» (то есть, 4 пути из 54 дифференциально активированных путей). В рамках этих путей также были идентифицированы клеточные каскады, связанные с поляризацией Th17 и действием иммунорегуляторного цитокина TGF-бета.

При активации и расширении наивные CD4 + Т-клетки развиваются в разные подмножества Th-клеток, которые проявляют различные профили цитокинов и эффекторные функции для защиты организма от различных типов возбудителей. До недавнего времени Т-клетки были разделены на клетки Th1 и Th2 в зависимости от полученных ими цитокинов (например, IFN-гамма и TNF-бета по сравнению с IL-4, -5 и -13, соответственно).

Недавно было обнаружено третье подмножество продуцирующих IL-17 эффекторных Th-клеток, называемых клетками Th17. Участие TGF-бета в дифференцировке клеток Th17 связывает линию Th17 в тесной связи с CD4 + CD25 + Foxp3 + регуляторными Т-клетками (Tregs) [19].

T1D является аутоиммунным заболеванием, которое возникает в результате селективного разрушения бета-клеток поджелудочной железы Т-клетками, и развитие этого заболевания, скорее всего, связано с взаимодействием между экологическими и генетическими факторами. CD4 + Т-клетки в значительной степени связаны с патогенезом этого заболевания, и считается, что T1D является преимущественно заболеванием, вызванным Th1. Кроме того, повышенная экспрессия IL-17 была обнаружена в тканях сыворотки и мишени пациентов с различными аутоиммунными заболеваниями, а на животных моделях IL-23, фактор стабилизации Th17, участвует в развитии аутоиммунного диабета. Дифференциацию клеток Th17 инициируют TGF-бета, IL-6 и IL-21, которые активируют STAT3 и индуцируют экспрессию транскрипционных факторов, включая ретиноевую кислоту, связанную с сиротным рецептором (RORgamma t). У людей активность Th17, по-видимому, вызывает мультиорганное воспаление, способствуя проявлению ревматоидного артрита, воспалительного заболевания кишечника и целиакии [20].

В этом уникальном исследовании по экспрессии генов и функциональному анализу мы продемонстрировали, что пути «дифференцировки Th17», «IL-22» и «Развитие сигнальных путей TGF-бета-рецепторов» были среди наиболее значимых разных путей, идентифицированных, когда пациенты с T1D были сопоставлены с здоровым контролем. Различие в активации пути «Th17 signaling» также наблюдалось, когда мы сравнивали пациентов с T1D с родственниками. В соответствии с этими данными мы ранее сообщали, что предвзятость в производстве IL-10 и TGF-бета на уровне белка является типичной для фазы преддиалемы [21, 22].

Используя мышечную модель заболевания, две группы ранее сообщали, что перенос островковых специфических клеток Th17 индуцировал диабет, хотя этот эффект был очевидным только после того, как клетки были преобразованы в клетки, продуцирующие IFN [23, 24]. Хотя TGF-бета и IL-21 могут приводить к тому, что наивные CD4 + клетки дифференцируются в клетки Th17, которые секретируют IL-17 у людей, было продемонстрировано, что клетки CD4 + с центральной памятью можно приводить к секреции IL-17 с помощью комбинации IL-1 и IL-6 [25-28]. Брэдшоу и его коллеги изучали моноциты, непосредственно выделенные из крови пациентов с T1D, и обнаружили, что клетки спонтанно секретировали провоспалительные цитокины IL-1 beta и IL-6, которые, как известно, индуцируют и расширяют клетки Th17. Более того, эти активированные in vivo моноциты индуцировали больше клеток, секретирующих IL-17 из Т-клеток памяти, по сравнению с моноцитами здоровых контрольных субъектов. Индукция Т-клеток, секретирующих IL-17 моноцитами пациентов с T1D, была снижена in vitro с помощью комбинации антагониста IL-6-блокаторов и антагониста IL-1R. В этом исследовании авторы также сообщили о значительном увеличении частоты клеток, секретирующих IL-17, в лимфоцитах у долгосрочных пациентов с T1D по сравнению с здоровым контролем. Эти данные свидетельствуют о том, что врожденная иммунная система у пациентов с Т1D может управлять адаптивной иммунной системой, расширяя популяцию Th17 эффекторных Т-клеток [29]. В соответствии с результатами этого отчета наши данные также свидетельствуют о том, что «предзнаменование Th17 может присутствовать через много лет после начала заболевания и указывать на существование определенного« аутореактивного потенциала »иммунной системы.

IL-9 представляет собой цитокин, полученный из Т-клеток, который первоначально был охарактеризован как цитокин Th2. Секреция IL-9 недавно была приписана новому подмножеству CD4 + T-клеток, называемому клетками Th9 у мышей. Однако IL-9 также может быть секретирован клетками мыши Th17 и может опосредовать аспекты провоспалительной активности клеток Th17 [30]. Beriou и его коллеги сообщили, что IL-9 секретируется человеческими наивными CD4 + Т-клетками в ответ на дифференцировку в условиях поляризации Th9- (т. Е. TGF-бета и IL-4) или Th17- (т. Е. TGF-бета и IL-6) , Тем не менее, эти дифференцированные наивные клетки не сосуществовали с IL-9 и IL-17, если клетки не подвергались многократной стимуляции в условиях индуцирования дифференцировки Th17. Эти авторы продемонстрировали, что у пациентов с аутоиммунным диабетом наблюдаются более высокие частоты CD4 + Т-клеток памяти и что активация этих клеток в присутствии TGF-бета индуцирует реакцию CD4 + Т-клеток с памятью, в которой доминируют IL-9 и IL-17, сопровождаемые потеря цитокинов Th1 и Th2. Эти данные показывают, что присутствие IL-9 + IL-17 + CD4 + T-клеток, индуцированных IL-1-бета, может играть роль в аутоиммунном заболевании человека [30].

Неудивительно, что самым высоким показателем для сравнения пациентов с T1D и их здоровыми аналогами было «Презентация Antigen от MHCII»; действительно, хорошо известно, что гены, кодирующие молекулы HLA класса II, являются наиболее важными «T1D-ассоциированными генами» [10]. Также неудивительно, что другие пути, связанные с критическими процессами специфического иммунного ответа, такие как «сигнальный путь рецептора Т-клеток», продемонстрировали различия в активации у пациентов с T1D. Аналогичным образом, существенные различия в сигнальной связи GTPase семейства Rho, а именно пути Rac3 и Cdc42, которые регулируют организацию цитоскелета и обмен веществ в мембранах и были предложены для связи с диабетом [31], были среди десяти лучших пройденных путей.

Глюкозо-стимулированная секреция инсулина из бета-клеток островков включает секреторный перенос гранул, высококоординированный процесс, который включает изменения в цитоскелетной архитектуре с помощью G-белков и их соответствующих эффекторных молекул. Малые G-белки включают Cdc42, Rac1 и ARF-6, с соответствующими регуляторными факторами, включая факторы ВВП / GTP-обмен и ингибиторы диссоциации ВВП. В дополнение к их положительным модуляционным ролям некоторые небольшие белки G также способствуют метаболической дисфункции и кончине бета-клеток островков, которые наблюдаются в моделях нарушенной секреции инсулина и диабета in vitro и in vivo [32].

Путь передачи костного морфогенного белка (BMP) также появился в списке дифференциально активированных путей, когда пациентов сравнивали с контрольными, а также с родственниками. Хорошо известно, что диабетическая нефропатия является основной причиной возникновения почечной недостаточности на конечной стадии. Кроме того, TGF-бета-BMP-путь был вовлечен в патогенез диабетической нефропатии. Гены BMP2, BMP4 и BMP7 расположены вблизи пиков связи для почечной дисфункции, и было высказано предположение, что генетические полиморфизмы в этих биологических и позиционных генах-кандидатах могут представлять собой фактор риска развития диабетической болезни почек; однако общие полиморфизмы гена BMP не оказывают сильного влияния на генетическую восприимчивость к диабетической нефропатии у белых индивидуумов с T1D [33]. Ни один из испытуемых пациентов не имел диабетической нефропатии во время отбора проб, но может быть корреляция между этими симптомами и более высокий риск развития хронических диабетических осложнений. Недавно было также высказано предположение, что сигнализация TGF-бета / BMP-6 у пациентов с диабетом способствует усилению клеточной дифференциации циркулирующих клеток-предшественников гладких мышц [34].

Было только ограниченное число исследований экспрессии генов T1D. Одним из примеров является отчет Кайзера и его коллег [16], который проанализировал экспрессию генов PBMCs, полученных от педиатрических пациентов с T1D и T2D. Авторы обнаружили, что T1D и T2D, по-видимому, имеют общий путь развития бета-клеточной дисфункции, который включает секрецию белков IL-1 и простагландинов иммунными эффекторными клетками, хотя авторы не тестировали эффект стимуляции аутоантигена. В Чешской Республике T2D редко встречается у детей; поэтому мы не сравнивали наши данные с данными, полученными от пациентов с Т2D, которые обычно принадлежат к более пожилому населению. Reynier и его коллеги тестировали родственников первой степени у пациентов с T1D, но эти авторы также не включали аутоантигенное воздействие в свои эксперименты, аналогичные Kaizer et al. [16]. Таким образом, наше исследование представляется совершенно уникальным в том смысле, что оно сравнивает эффекты стимуляции аутоантигена на клеточных процессах в ПМБК в нормальном и аутоиммунном состояниях диабета.

Одним из потенциальных недостатков нашего исследования является ограниченное количество тестируемых образцов. Однако мы считаем, что примерно 10 субъектов на группу достаточны для выявления генов со статистически значимыми изменениями уровней их экспрессии генов, когда используются чипы микрочипов высокой плотности. В этом контексте и во многих других аспектах результаты этого исследования параллельны нашей предыдущей работе [35] и исследованиям других исследовательских групп, в которых анализ микрочипов, полученных от ограниченного числа субъектов, обеспечивал очень важные и статистически значимые данные [16, 36 -38]. Более того, хотя наша контрольная группа не идеально соответствовала нашим другим исследовательским группам, эта переменная оказывает незначительное влияние на наш статистический анализ (данные не показаны) в соответствии с нашим всесторонним статистическим анализом, описанным в другом месте [35]. В качестве примера наша оценка влияния возраста и пола на выражение CD4 статистически незначима.

В заключение можно сделать вывод, что важные различия наблюдались, когда активацию клеточных процессов после искусственного воздействия на аутоантигены, связанные с диабетом, сравнивали между пациентами T1D, их родственниками первой степени и здоровым контролем. Были задействованы важные пути, связанные с иммунным ответом, с высокой степенью изменчивости, наблюдаемой для этих путей, когда либо пациентов с Т1Д, либо их родственников сравнивали с здоровым контролем. Эти важные процессы, связанные с иммунным ответом, в основном включали индукцию ответов Th17 и Th22, а также цитоскелетные перегруппировки, презентацию MHCII и усиление CD4, TGF-бета и STAT3. Эти данные потенциально предполагают, что эти процессы могут быть использованы в качестве прогностических маркеров для развития T1D или в качестве молекулярных мишеней для репрессии конкретных популяций иммунокомпетентных клеток для лечения диабета.

Подробное описание состояния аутоантител к исследуемой когорте можно найти в таблице 1. Наибольшие изменения в экспрессии гена 20 up- или downregulated генов среди наших групп перечислены в таблице 2s.

Щелкните здесь для получения дополнительных данных.

Радек Блатны, Збинек Хальбхубер, Михал Колар, Доминик Филипп и Катерина Стечова внесли одинаковый вклад в эту работу.

Эта работа была поддержана проектом NPVII 2B06019 от Министерства образования Чехии и частично грантом RVO: 68378050 от Академии наук Чешской Республики, а также Министерством здравоохранения Чешской Республики посредством концептуального развития исследовательской организации 00064203 (Университетская больница Мотоль, Прага, Чешская Республика) и IPL 699 001 (отделение педиатрии, 2-й медицинский факультет, Прага, Чешская Республика). Авторы также любят признавать Милусе Хубацкова, Вендулу Ставикову и Барбору Оберманнову за выборку предметов исследования и обработки образцов.

T1D пациентов

Родственники первой степени у пациентов с Т1D

Родственники пациентов T1D, у которых аутоантител (-и) отрицательный

Родственники пациентов T1D, которые являются аутоантителами (-ами) положительными

Контроль (здоровые добровольцы)

Сменить смену

Аутоантитела к декарбоксилазе антиглутаминовой кислоты (GAD65)

Антацитрозинфосфатаза (IA-2) аутоантитела

Аутоантитела к инсулину.

Проверка данных микроматрицы гена. Относительная экспрессия TGF beta1, STAT3 и CD4 с помощью qRT-PCR (данные были получены из независимой когорты из 14 пациентов с диагнозом T1D и 12 здоровых добровольцев).

Гены дифференциально активируются в каждой группе (формирование кластеров). Усовершенствованная тепловая карта экспрессии гена была построена с использованием интенсивности сигнала зонда, которая имела изменение логарифмической шкалы, которая была больше +1 или меньше -1. Гены, которые были значительно изменены в группе родственников, сгруппированы в определенные семейства генов.

Иммунный ответ и дифференцировка клеток Th17. Различия в поляризации Th17 наблюдались, когда контрольные образцы сравнивались с пациентами T1D с использованием данных микрочипов. Гены, представляющие интерес, были проанализированы с помощью qRT-PCR и, как было установлено, были активированы у пациентов с T1D. STAT3 и TGF-бета были выбраны в качестве представителей дифференцировки клеток Th17. Данные микрочипов показали, что CD4 является одной из наиболее значимо повышенных молекул у пациентов с Т1D.

Изучайте население.

Количество идентифицированных генов с разными уровнями экспрессии, когда различные группы испытаний подвергались сопоставлениям пары групп.

D: пациенты T1D; DRL: родственники первой степени пациентов T1D; DV: контроль (здоровые добровольцы).

(a) Карты 10 лучших путей GeneGo («пути иммунного ответа» выделены жирным шрифтом). (b) Полный список значимых «путей иммунного ответа» для каждого сравнения пары; указывается ранжирование пути (позиция каждого пути в списке).

(А)

(Б)

D: пациенты T1D; DRL: родственники первой степени пациентов T1D; DV: контроль (здоровые добровольцы).

Комментариев нет.

Добавить комментарий

Ваш e-mail не будет опубликован. Обязательные поля помечены *