Нажмите "Enter", чтобы перейти к контенту

Производство и характеристика моноклональных антител против V3 человека из клеток инфицированных ВИЧ-инфицированных индийских доноров

Production and characterization of human anti-V3 monoclonal antibodies from the cells of HIV-1 infected Indian donors
Источник: https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3493341/

Анализ моноклональных антител человека (mAbs), полученных от ВИЧ-1-инфицированных доноров, чрезвычайно способствовал идентификации чувствительных к нейтрализации эпитопов на гликопротеине оболочки ВИЧ-1. Третья вариабельная область (V3) является важной мишенью для gp120, в первую очередь из-за ее участия в связывании со-рецептора (CXCR4 или CCR5) и наличия эпитопов, распознаваемых широко нейтрализующими антителами.

В этом исследовании для производства mAb было привлечено тридцать три пациента с наименьшей вероятностью инфицирования ВИЧ-1 (18 мужчин и 15 женщин) в возрасте 20-57 лет (медиана = 33 года). MAb были выбраны из EBV трансформированных культур с конформационно ограниченным холеротоксином-B, содержащим V3C (V3C-CTB) слитый белок. Мы тестировали mAb для их связывания с белками и пептидами, полученными из ВИЧ-1, с помощью ELISA и для нейтрализации вирусов ВИЧ-1 с помощью TZM-bl-анализов.

Мы выделили три mAb против V3, 277, 903 и 904 из клеток разных людей. Связывание с ELISA выявило специфическое связывание антитела 277 и 903 подтипа-C и подтипа A, в то время как mAb 904 проявлял перекрестную реактивность также с подтипом B V3. Эпитопное отображение mAb с перекрывающимися пептидами V3 показало исключительное связывание с венцом V3. Антитела проявляли высокую и низкую нейтрализующую активность против вирусов 2/5 уровня 1 и 1/6 уровня 2 соответственно. В целом мы наблюдали резистентность вирусов уровня 2 к нейтрализации с помощью анти-V3-mAb, несмотря на обнаружение эпитопов, распознаваемых этими антителами, на двух типичных нативных вирусах (Du156.12 и JRFL), что указывает на то, что сродство mAb может одинаково важны для нейтрализации, как признание эпитопа.

Наше исследование показывает, что антитела против V3, полученные от инфицированных индивидуумами подтипов C, демонстрируют потенциал нейтрализации против вирусов уровня 1, тогда как такая активность может быть ограничена против более устойчивых вирусов уровня 2. Определение специфичности тонких эпитопов этих mAb и дальнейших экспериментальных манипуляций будет полезно для идентификации эпитопов, уникальных для кладеи C или совместно используемых с неклапановыми C-вирусами, в контексте области V3.

Нековалентно связанная поверхность (gp120) и трансмембранные (gp41) субъединицы гликопротеина оболочки одеты на поверхность вируса иммунодефицита человека 1-го типа (ВИЧ-1) в виде тримерного шипа [1] и служат мишенью для широко нейтрализующие моноклональные антитела (bNAbs) [2-4]. Из-за его участия в первичных стадиях рецептора [5] и связывания с корецепторами [6] оболочка gp120 была идентифицирована как основная мишень для NAbs ВИЧ-1 [2,7-10]. Тем не менее, антигенная изменчивость выявленных областей и низкая иммуногенность консервативных доменов на gp120 налагают большие трудности для выявления уязвимых мишеней на ВИЧ-1 [2,4,11]. Тем не менее, сохраненные эпитопы на gp120 были идентифицированы с использованием антител из нейтрализующих сывороток [12-14] и bNAbs [9,10,15-17], которые включают антитела, направленные на сайт связывания с CD4-рецептором (CD4bs) и со-рецептор связывающий сайт в основном третьей вариабельной области (V3) [10, 18-22].

Кристаллическая структура V3, разрешенная в последнее время, показывает, что V3 выступает из ~ 30 Å из связанного с CD4 ядра gp120, и эту расширенную структуру можно разделить на три области: основание (остатки 1-8 и 25-35), стержень (9 -14 и 18-24) и корону (остатки 15-17) (остаток по V3) [23,24]. Цикл V3 gp120 является очень антигенным у людей [25-28] и ранее был признан основным нейтрализующим доменом ВИЧ-1 [29]. Однако было показано, что его роль ограничивается типе-специфическими вирусами [30,31], и такое наблюдение подтверждается обширным изменением последовательности в V3 из разных вирусных изолятов [32,33]. Учитывая критическое взаимодействие с корецепторами (CXCR4 или CCR5) на клетках-хозяевах, V3 обычно должен сохранять структурно консервативные элементы, необходимые для связывания [34,35]. В последнее время исследования показали, что домен V3 обладает консервативными структурными мотивами, несмотря на изменение последовательности, и часто доступен на поверхности вируса в качестве мишени для bNAbs [21,36-38].

Несмотря на то, что петля V3 демонстрирует высокое структурное сохранение, все же степень поперечно-реактивного ответа против V3-антитела у лиц, инфицированных различными подтипами ВИЧ-1, существенно различается [39]. Было показано, что это различие в реакции антител к V3-петле определяется в основном четырьмя амино-остатками в короне V3 (GPGQ или GPGR), которые в основном образуют β-оборот типа II [19,40]. Интересно, что моноклональные антитела против V3 (mAb), выделенные из инфицированных индивидуумов, отличных от кладин B, с GPGQ на кончике V3, демонстрируют лучшую способность к нейтрализации, чем подтип-B (с GPGR), выводят mAb против V3 [19]. Такое наблюдение было подтверждено исследованием, показывающим высокий потенциал нейтрализации mAb против V3, полученных от субъектов Камеруна, инфицированных вирусами, несущими GPGQ (подтип-AG) на венце V3 [21]. Кроме того, в исследовании иммунизации, проведенном у кроликов с gp120-ДНК-праймером, с последующим усилением с помощью различных слитых белков холера-токсина B (CTB), содержащих последовательности V3 из разных подтипов ВИЧ-1, слитый белок CTB, содержащий консенсус-C ( con-C) V3-последовательность (V3C-CTB) (имеющая мотив GPGQ на венце V3), вызвала сильную нейтрализующую реакцию ВИЧ-1 по сравнению с другими конструкциями V3-CTB [41].

До сих пор было создано ограниченное количество mAb против вирусов подтипа HIV-1, включая mAb против цикла V3, несмотря на то, что подтип C составляет более 50% глобальных инфекций ВИЧ-1 [42]. Единственным известным человеческим анти-V3 bNAb является зараженный пациентом КЛАД [15]. Учитывая приведенные выше факты, мы создали здесь три антибактериальных антитела против V3 от ВИЧ-инфицированных индийских пациентов с использованием метода иммортализации EBV технологии гибридомы человека. Функциональный анализ антител ВИЧ-1, полученных в этом исследовании, показал кресто-реактивное связывание и нейтрализацию тестируемых вирусов.

Было создано в общей сложности 3321 культуральных лунок (96-луночный планшет) РВМС, полученных из 33 ВИЧ-инфицированных пациентов. Через 2-3 недели культуральные супернатанты приблизительно 6% трансформированных лунок испытывали положительный результат для реактивности с V3C-CTB (таблица 1). Три гетерогибридомы, продуцирующие mAb против V3, были получены у разных людей (IDs, 277, 903 и 904). MAb относятся к подклассу IgG1 с одним (904) с использованием лямбда и двух других (277 и 903) с генами легкой цепи каппы. Интересно отметить, что в каппа легкой цепи Abs показано то же самое использование гена тяжелой цепи (IGHV) иммуноглобулина (IGHV) (3-30 * 03), тогда как у другого Ab (904) показано использование гена 1-8 * 01 (таблица 2). Определяющая комплементарность область 3 для тяжелой цепи (CDRH3) была различной для каждого mAb, указывающего их уникальность (таблица 2).

Характеристики скрининга EB-трансформированных культур В-клеток с V3C-CTB

Для получения антител было набрано 133 ВИЧ-1 инфицированных наркотика.

Из этих 33 пациентов было выделено 321,2 млн. РВПМ со средним значением 9,72 млн. На человека (диапазон от 1,7 до 30 млн.).

3 РВМС были высеяны в 96-луночных планшетах для культуры тканей 80-100 кл / лунку и приблизительно 6% (199/3321) лунок были положительными с V3-CTB4.

Были стабилизированы три анти-V3 моноклональные антитела, секретирующие клоны 277, 903 и 904.

Иммуногенетический анализ моноклональных антител против V3 человека

1Three анти-V3 моноклональные абс были получены от инфицированных ВИЧ-1 индийских доноров.

2Иммуноглобулиновый ген для тяжелых (IGHV) и аминокислотных последовательностей доменов 3CDRH3 определяли с использованием системы IMGT; звездочка указывает аллель.

Все образцы плазмы у пациентов, набранных для этого исследования, ранее подвергались скринингу на их относительное связывание с пептидами V3C и V3B (Andrabi et al., Представленный), и здесь приведены данные только для трех образцов, из которых были выделены mAb против V3 ( Рисунок 1С). Анализы пептидного связывания выявили потенциал перекрестного реактивного связывания анти-V3 Abs в образце плазмы 277 и 904, тогда как 903 показали специфическое связывание субтипа-C V3.

Относительная аффинность связывания антител против V3 к пептидам и белкам, полученным из ВИЧ-1. Схема связывания mAb против V3, полученная от индийских доноров (красный) и 447-52D (анти-V3 Ab, выделенных из инфицированного ВИЧ-1 подтипа-B, инфицированного американского индивидуума) (зеленый) до консенсус-C и B V3-пептидов (1A ) и субтипа-C (Du156.12) и подтипа-B (JRFL), полученных огибающей gp120 белков (1B). Связывание mAb против V3 тестировали с помощью ELISA с использованием mAb в концентрации от 10 до 0,00003 мкг / мл (12 разведений). В качестве отрицательного контроля использовали человеческий антипаравирус B19 mAb 1418. Относительная реактивность анти-V3-плазменных антител к консенсус-B и C V3-пептидам показана в терминах 50% титров связывания ELISA (Max50) для трех пациентов, у которых были получены антитела (1С). В двух образцах плазмы 277 и 904 показано крестообразное реактивное связывание, в то время как 903 показало специфическое связывание подтипа-С.

Чтобы определить специфичность mAb против V3, генерируемых этими тремя пациентами, мы выполнили ELISA-связывающее титрование mAb против V3 с белками gp120 с рекомбинантной оболочкой и пептидами, полученными из ВИЧ-1 (таблица 3). В дополнение к трем индийским анти-V3 mAb, которые были получены в этом исследовании, мы также протестировали связывание анти-V3 bNAb (447-52D), выделенного из инфицированного ВИЧ-инфицированного человека подтипа B, живущего в США. Кривые связывания mAb с con-C и B V3-пептидами и субтипами-C (Du156.12) и B (JRFL) gp120-белками показаны на репрезентативном рисунке 1. mAb также тестировали с помощью ряда пептидов и белков для цель контроля качества и максимальные связывающие титры с максимальным связыванием (Max50) суммированы (таблица 3). В целом, mAb 277 и 903 показали связывание с подтипом A или C V3, в то время как антитело 904 также реагировало с областью V3 подтипа B (рисунок 1A-B, таблица 3). Мы дополнительно тестировали mAb с помощью анализов связывания ELISA с использованием линейных перекрывающихся пептидов, охватывающих в основном область V3, окруженную второй константой (C2) и третьей константной (C3) областью gp120, для идентификации распознаваемого эпитопа ядра и обнаружили, что все эти mAb против V3, включая mAb 447-52D, связываются с короной V3-петли (таблица 4).

Связывание mAb с субтипами-A, B и C-продуцируемыми белками ВИЧ-1 и пептидами

1 Список рекомбинантных белков и пептидов, полученных из вирусов подтипа A, B и C HIV-1, NA: не применимо.

2Fur антитела против V3, три из IndianI (277, 903 и 904) и один из доноров, инфицированных ВИЧ-1 от AmericanA (447-52D), были протестированы на предмет их относительного связывания. Связывающую активность mAb против V3 против белков и пептидов тестировали с помощью ELISA с использованием mAb в концентрации от 10 до 0,00003 мкг / мл (12 разведений). 50% -ный связывающий титр (Max50, конц. Мкг / мл) каждого антитела против соответствующего белка или пептида изображен как числовые значения в жирном (с высоким сродством), курсив (с низким сродством) и> 10, где значение Макс. 50 не было достигнуто , В качестве отрицательного контроля использовали человеческий антипаравирус B19 mAb 1418. Каждый эксперимент проводился как минимум два независимых раза.

Эпитопное отображение mAb против V3 с консенсус-C V3 перекрывающимися пептидами

1Аминокислотные последовательности линейных перекрывающихся пептидов, охватывающих третья вариабельная область (V3: подчеркнутая (средняя)), фланкированные вторыми (C2: (слева)) и третьей (C3: (справа)) константными областями и выровнены с соответствующим консенсусом, C gp120.

2Four антитела против V3, три из IndianI (277, 903 и 904) и один из доноров, инфицированных ВИЧ-1 от AmericanA (447-52D), были протестированы на предмет их связывания с перекрывающимися пептидами с помощью ELISA с использованием mAb в концентрации от 10 до 0,00003 мкг / мл (12 разведений).

50% -ный связывающий титр (Max50, конц. Мкг / мл) каждого антитела против соответствующих пептидов изображен как числовые значения в жирном (с высоким сродством), курсивом (с низким сродством) и> 10, где значение Макс. 50 не было достигнуто. В качестве отрицательного контроля использовали человеческий антипаравирус B19 mAb 1418. Каждый эксперимент проводился как минимум два независимых раза.

Связывание пептидов или белков, полученных из Abs-HIV-1, не обязательно означает, что эти mAb могут связывать интактные вирусы, которые по существу представляют более нативную конформацию. Чтобы решить эту проблему, мы протестировали mAb против V3 для связывания с вирусами Du156.12 (подтип-C) и JRFL (подтипы-B) в анализе интактного вирионного связывания. Два этих вируса (Du156.12 и JRFL) были выбраны для этого эксперимента на основе их сходства по последовательности V3 с соответствующей последовательностью con-C и B V3 (рис. 2C). В соответствии с привязкой mAb против V3 к Du156.12 и белкам gp120, полученным из JRFL, три mAb показали сродство к дифференциальному связыванию с интактными вирионами, 904 с высоким сродством по сравнению с 277 и 903. Кроме того, mAb 904 сохранял перекрестно-реактивный потенциал связывания с интактными вирусами, что видно из схемы связывания (рисунок 2A). Эксперимент был проверен путем тестирования интактного вирионного связывания анти-V3 mAb 447-52D с вирусом SF162, который, как известно, обладает хорошо открытой областью V3 и обеспечивает доступность к Ab без каких-либо помех [43-45]. Связывание бесплодного вируса 447-52D с SF162 выявило очень высокую аффинность связывания (более пяти раз) mAb 447-52D по сравнению со связыванием трех mAb против V3 с Du156.12 и JRFL при эквивалентной концентрации вируса (i, e 25 нг / мл) (фиг. 2A-B). Это дифференциальное связывание mAb с интактными вирионами также может быть связано с числом потенциальных сайтов N-гликозилирования (PNGS) в области V1 / V2 (3 для SF162, тогда как 6 и 7 PNGS для Du156.12 и JRFL соответственно) этих вирусов [46]. В целом, результаты свидетельствуют о том, что эпитопы V3, распознаваемые тремя mAb против V3, были показаны как на Du156.12, так и на JRFL, однако mAb 277 и 903 не смогли связывать JRFL из-за их специфической связывающей активности подтипа.

Связывание mAb против V3 с родными вирусами. Связывание анти-V3 MAbs с родными, неповрежденными вирионами ВИЧ-1, Du156.12 (подтип-C) и JRFL (подтип-B). Супернатанты двух вирусов использовали при конечной концентрации p24 25 нг / мл. Антитело 904 показало связывание с обоими вирусами (Du156.12 и JRFL), тогда как антитела 277 и 903 показали специфическое связывание подтипа C (Du156.12) (A). Несвязанный mAb 1418 против парвовируса B19 служил отрицательным контролем. Для подтверждения эксперимента использовали анти-V3 mAb 447-52D (известные для связывания SF162, clade-B-вирус) и SF162. Связывание 447-52D с интактным вирусом осуществляли с использованием фиксированной концентрации антитела (10 мкг / мл) с двухкратным разбавлением вируса SF162, начиная с 50 нг / мл вируса (В). Захват вируса определяется путем измерения уровня p24 (пикограмм на миллилитр), высвобождаемого при лизировании связанного вируса моющим средством. Вирусы (Du156.12 и JRFL) были выбраны для анализа интактного вирионного связывания на основе их сходства с последовательностями консенсуса B и C V3 (C). Последовательность V3 этих вирусов согласовывается с их последовательностью консенсуса-C и B V3 с использованием программы Seqpublish (http://hiv.lanl.gov).

Антитела против V3 были протестированы для оценки их способности нейтрализовать панель из 11-го уровня 1 и 2 вирусов из разных подтипов ВИЧ-1, используя стандартный анализ клеток TZM-bl. MAb против V3 показал эффективную нейтрализацию против двух, подтипа-A (DJ263) и подтипа-C (MW965), из пяти вирусов уровня 1, в то время как только один вирус (подтип-C, ВИЧ-001428) из шести вирусы второго уровня были нейтрализованы двумя mAb (903 и 904) с относительно низкой эффективностью (таблица 5). Ни один из индийских анти-V3-mAb не смог нейтрализовать любой из подтипов B-вирусов, несмотря на то, что антитело 904 демонстрирует перекрестное реактивное связывание, тем не менее количество протестированных здесь вирусов было ограничено. Напротив, mAb 447-52D достигал титров нейтрализации IC50 с тестируемыми 5/11 вирусами в соответствии с предыдущими исследованиями [15,19].

Нейтрализация вирусов ВИЧ-1 с помощью mAb против V3 в анализе TZM-bl

Кросс-нейтрализующая активность mAb, вырабатываемая у индийских пациентов, наряду с 447-52D (также анти-V3-антителом) оценивалась по уровням 1 и 2 подтипов A, B, C вирусов, указанных слева. Антитела показаны с идентификаторами антител (числовые значения жирным шрифтом) в верхней части каждой колонки. В качестве отрицательного контроля использовали человеческий антипаравирус B19 mAb 1418. Числовые значения в приведенных ниже графах — это 50% титров нейтрализации (IC50), определяемых как концентрация (мкг / мл) mAb, которая нейтрализовала 50% вирусной инфекции в анализе. Для ясности эта информация кодируется: IC50 <1 мкг / мл; (Полужирный), IC50> 1 мкг / мл; (Курсив) и> 30, где IC50 не был достигнут. Каждый эксперимент проводился как минимум два независимых раза.

Человеческие моноклональные антитела против гликопротеинов оболочки ВИЧ-1 являются полезными инструментами в структурном и функциональном анализе вирусной оболочки и играют решающую роль в разработке дизайна профилактических вакцин против ВИЧ. Несмотря на огромное расширение подтипа ВИЧ-1 во всем мире, вирусы clade-C остаются одним из наименее изученных подтипов, особенно с точки зрения нейтрализующих антитела к ВИЧ-1. Используя обоснование предыдущих исследований, показывающих, что вирусы с остатками GPGQ на кончике венца V3 оболочки ВИЧ-1 индуцируют мощные и поперечно-реактивные NAbs по сравнению с вирусами с мотивом GPGR, мы создали здесь три mAb против V3 от индийских доноров предположительно зараженных вирусами подтипа-С, несущими GPGQ на венце V3 [42]. Функциональный анализ продуцируемого Abs выявляет мощный потенциал нейтрализации с вирусами уровня 1, в то время как такая активность была ограничена тестируемыми вирусами уровня 2.

Анти-V3 Abs были выбраны из EBV-трансформированных B-клеточных культур из 33 ВИЧ-инфицированных пациентов с антиретровирусным лекарственным препаратом, использующих слитый белок V3C-CTB [47]. Ранее было продемонстрировано преимущество использования конформационно ограниченного вместо линейного V3-пептида для отбора mAb из культур или как животных иммуногенов [36,41,48-50]. Мы обнаружили 1-25% (среднее значение = 6%) преобразованных скважин, положительных для связывания с V3C-CTB в первом скрининге. Характерный характер В-клеток у ВИЧ-инфицированных субъектов и условия их увековечения, по-видимому, влияют на количество и тип продуцирующих Ab линий клеток, которые вырастают [51]. Общий положительный процент культивирующих колоний, выделяющих Ab, был относительно хорош и мог быть отнесен к высоким титрам реактивности против V3 Ab соответствующей плазмы [28]. В отличие от высокого процента положительных секреторов при первоначальном скрининге, мы смогли стабилизировать только три (277, 903 и 904) анти-V3 Ab-продуцирующих клона-клетки. Эта потеря может быть отчасти обусловлена ​​разрастанием не-секреторных В-клеток над В-клетками-секреторами на последующих стадиях вторичного скрининга, клеточного слияния и процесса клонирования разбавления. Кроме того, В-клетки у ВИЧ-1-инфицированных пациентов в основном дисфункциональны и поликлонально активированы [52], и такие свойства были связаны с низкой устойчивостью к ВЭБ-инфекции [51,53,54].

Изменение аминокислотной последовательности V3 по различным подтипам ВИЧ-1 часто связано с дифференциальным иммунным ответом, сфокусированным на V3, который, как ожидается, возникнет из-за специфических конформационных различий подтипа в области V3 [55, 56]. Например, остатки коронки V3 ВИЧ-1 VG в некладе B и GPGR в вирусах clade B соответственно являются основными детерминантами связывания и нейтрализации Ab [19, 40]. Эпитопное картирование анти-V3 Abs с перекрывающимися пептидами V3 показывает, что их основные эпитопы лежат только в краевой области. Действительно, недавние иммунологические и структурные исследования mAb против V3 наблюдали аналогичную схему связывания, в которой, по существу, все анти-V3 mAb связываются с ~ 14 остатками в венце V3 [57-59]. Два из наших mAb против V3 (277, 903) показали связывание с подтипом A или C, но не с белками и пептидами, полученными из подтипа B, в то время как mAb 904 проявлял перекрестное реактивное связывание с подтипом B. Схема связывания (в контексте специфичных к кладе или поперечно-реактивных V3-антител) двух анти-V3 mAbs 903 и 904 была аналогична связыванию поликлональных антител против V3 плазмы от соответствующих пациентов, однако для mAb 277 в контекст плазмы Abs этого пациента (рис. 1A-C). Обнаружение подчеркивает важность предварительного скрининга плазмы для связывания с пептидами из разных вирусных подтипов до выделения mAb. Одна из правдоподобных причин невязки mAb 277 с V3B-пептидом в отличие от его соответствующей поликлональной плазмы может быть связана с большим количеством специфических клонов B-клеток подтипа-C в репертуаре B-клеток этого пациента, о чем свидетельствует его очень высокое связывание с V3C (рис. 1C). Это также частично может быть отнесено к предвзятому выбору с помощью конструкции CTB, содержащей только последовательность V3C, которая может позволить ей преимущественно собирать клон В-клеток с специфичностью Clade-C V3. Интересно отметить, что mAb против V3 277 и 903, в которых показано, что clade-A или C (оба имеют общий мотив кроны GPGQ) специфического связывания используют один и тот же ген переменной тяжелой цепи (VH3-30), тогда как кресто-реактивный mAb 904 использует разные VH (таблица 1). Обнаружение предполагает возможную связь использования гена антител с эпитопной специфичностью, однако количество mAb, сгенерированных в этом исследовании, слишком мало для сравнения. Примечательно, что недавний анализ анти-ВИЧ-абс указывал на предпочтительное использование гена VH5-51 анти-V3 Abs [60], и впоследствии было показано, что предпочтение будет определять консервативную антигенную структуру внутри V3 [61] ,

Доступность Ab для местного вируса ВИЧ-1 часто оспаривается схемой гликозилирования и маскированием эпитопов [39,62,63]. Этот эффект был особенно признан для области V3, где соседние области, включая V1 / V2, защищают эпитопы, распознаваемые анти-V3 Abs [46]. Хотя исследования показали, что петля V3 ВИЧ-1 остается доступной на большинстве вирусов [36], однако эта информация ограничена вирусами подтипа-В и остается изученной для других подтипов. В соответствии со связыванием с белками gp120 (Du156.12 и JRFL) три антибактериальных антитела против V3 могли связывать интактные нативные вирионы с аналогичной схемой связывания (рисунок 2A). Полученные результаты свидетельствуют о том, что эпитопы V3 хорошо подвержены воздействию интактных тримерных вирусов (Du156.12 и JRFL), и эти результаты подтверждены предыдущей работой в литературе [36,43]. Обоснование использования тех же белков (gp120) и соответствующих ему вирусов (интактный вирион) для анализа связывания заключалось в минимизации влияния как последовательности V3, так и соседних областей на локальную и глобальную ориентацию V3 и на последующие связывание Abs.

MAb против V3 проявлял сильную нейтрализующую активность против вирусов подтипа A и C уровня 1, однако эта активность была ограничена для уровня 2, особенно вирусов подтипа-B. Обнаружение было интригующим, учитывая способность mAb против V3 связываться с двумя репрезентативными интактными вирионами подтипа-B (JRFL) и подтипа-C (Du156.12) и, тем не менее, не достигать титров нейтрализации IC50. Однако следует отметить, что mAb 903 и 904, которые показывают лучшее сродство, чем 277, показали нейтрализацию до 19% при 30 мкг / мл, хотя и не достигали титров нейтрализации IC50, причем эти вирусы (данные не показаны). В целом, данные свидетельствуют о том, что более высокие концентрации этих mAb могут быть эффективными при нейтрализации, однако это необходимо подтвердить в деталях. Вместе эти результаты показывают, что эффективные концентрации для связывания и нейтрализации могут существенно различаться, и высокое сродство связывания mAb может иметь решающее значение для нейтрализации. Данные подтверждены различными исследованиями, проведенными ранее [15, 36].

Мы выделили здесь три mAb против V3 от ВИЧ-1-инфицированных доноров из Индии, которые могут эффективно нейтрализовать вирусы уровня 1, но менее эффективны с вирусами уровня 2, однако это необходимо подтвердить, протестировав их с помощью более широкой группы вирусов из разных ВИЧ-инфицированных -1 подтипов. Это исследование демонстрирует важность предварительного скрининга плазмы Abs для кросс-реактивного связывания, для производства mAb, и эта идея может быть также использована для других антигенных областей. Также в исследовании подчеркивается важность сродства к антителу, которое, вероятно, может быть столь же важно, как и его доступность эпитопа, для эффективной нейтрализации вируса. Кроме того, анализ mAb, сгенерированный в этом исследовании, позволит нам идентифицировать эпитопы, которые являются уникальными для вирусов Clade C, а также те, которые разделяются с другими подтипами в контексте цикла V3, и данные могут предоставить полезную информацию для ВИЧ- 1.

Исследование было одобрено комитетом по этике Всеиндийского института медицинских наук (AIIMS) в Нью-Дели, а письменное информированное согласие на исследование и публикацию данных было получено от всех участников.

В этом исследовании в этом исследовании из Регионального учебного и научно-исследовательского центра по ЗППП, больницы Сафдарджанга, в возрасте от 20 до 57 лет (медиана = 33 года) было привлечено тридцать три наивных пациента с серопозитивным наркотиком ВИЧ-1 (18 мужчин и 15 женщин) Нью-Дели, Индия, в период 2008-2011 годов. У пациентов средний показатель CD4 составил 449 (диапазон = 203-966) клеток / кубический миллиметр (дополнительный файл 1: таблица S1). Образцы цельной крови ВИЧ-1-положительных доноров собирали в вакуумерах ЭДТА, плазму отделяли центрифугированием при 300 г и хранили в аликвотах при -80 ° С до использования. Образцы плазмы подвергали тепловой инактивации при 56 ° С в течение 1 ч перед использованием в анализах. Ранее было показано, что у пациентов были высокие титры анти-V3 Abs в их плазме, и значительная часть этих V3 направленных абс проявляла кросс-реактивность [28] (Andrabi et al., Представленный). Предположительно, пациенты были инфицированы вирусами подтипа-С, который является основным подтипом в Индии [64,65]. Действительно, последовательности огибающей (частичная C2-C5 оболочки gp120) нескольких пациентов показали, что большинство пациентов были инфицированы подтипами C-вирусов (Andrabi et al., Представленный).

MAb генерировали с использованием клеточных методов, как описано ранее [66]. Вкратце, мононуклеарные клетки периферической крови (РВМС) были EBV трансформированы в 96-луночные планшеты и культивировали с помощью поликлонального активатора В-клеток CpG [67], что усиливало инфекцию EBV и трансформацию В-клеток. Ячейки, содержащие клетки, продуцирующие Ab, идентифицировали путем тестирования супернатантов культуры для активности связывания с V3C-CTB [47]. Клетки из лунок, которые положительно оценивали, были расширены и слиты с клеточной линией гетеромиеломы SHM-D33 (ATCC, каталог № 1668). Слитые клетки, которые продолжали делать функциональные абс, неоднократно клонировали до достижения моноклональности. Абс очищали от культуральных супернатантов с использованием аффинных колонн Protein G (GE Healthcare), а концентрацию mAb определяли некоммерческим ELISA. Анти-V3 mAb 447-52D, сгенерированный ранее у инфицированного Clade B человека и mAb 1418, специфичный для парвовируса B19 [68], использовали в качестве контроля Abs в этом исследовании.

Нуклеотидную последовательность Ig-генов мужских антител против V3 определяли, как описано ранее [60,61]. Рентген-мессенджер экстрагировали из линий клеток гибридомы, продуцирующих mAb против V3, и обратную транскрибировали в кДНК с использованием олиго-dT-праймера. Амплификацию вариабельного фрагмента проводили с помощью ПЦР с использованием различных наборов праймеров семейства генов и кДНК в качестве матрицы. Пять прямых праймеров, VH 1/5 [5′-CAG GTG CAG CTG GTG CAG TCT GG-3 ‘, VH2 [5′-CAG GTC AAC TTA AGG GAG TCT GG-3′, VH3 [5’-GAG GTG CAG CTG GTG GAG TCT GG-3 ‘, VH4 [5′-CAG GTG CAG CTG CAG GAG TCG GG-3′ и VH6 [5’-CAG GTA CAG CTG CAG CAG TCA GG-3 ‘были расположены на 5′-конце V-генов , Обратный праймер [5’-CTTGGTGGARGCTGARGAGACGGTGACC-3 ‘был расположен на 3′-конце сегмента JH и до 12 нуклеотидов в 5’ константной области IgG [69]. ПЦР-амплификацию проводили с использованием программы циклирования 2 мин при 94 ° С, 35 циклов 60 с при 94 ° С, 60 с при 56 ° С и 90 с при 72 ° С, затем 8 мин при 72 ° С. Для визуализации продуктов ПЦР использовались 0,8% агарозные гели, покрытые бромидом этидия. Полосы соответствующего размера вырезали и очищали колонкой GeneElute Minus EtBr Spin Column (Sigma, США). ПЦР-продукты были секвенированы (Macrogen, Южная Корея) в обоих направлениях, используя праймеры, применяемые для амплификации. Данные последовательности были проанализированы с использованием международной информационной системы ImMunoGeneTics (IMGT) (http://imgt.cines.fr).

Пять рекомбинантных gp120s, представляющих последовательности первичных изолятов ВИЧ-1 из кланов A, B и C (продуцируемых в клетках 293) и белка p24, были приобретены у Immune Technology Corp. (Нью-Йорк, Нью-Йорк). Набор из 12 линейных перекрывающихся пептидов (каждый 15-мерный с перекрытием 11 аминокислот или 4-аминокислотная прогулка), соответствующий последовательности консенсусного подтипа-C V3 gp120 и контрольного пептидного пула CEF (PP) (№ 9808), был полученной в рамках Программы исследований и справочной реактивов NIH по СПИДу (NIH, ARRRP). Два полных (35 м) пептида, соответствующих консенсусу -B (CTRPNNNTRKSIHIGPGRAFYTTGEIIGDIRQAHC) (V3B) и con-C (CTRPNNNTRKSIRIGPGQTFYATGDIIGDIRQAHC) (V3C) V3 gp120, 24-мерный con-C MPER (DLLALDSWKNLWNWFDITNWLWYIK) и 19-мерный кон-C IDR ( LGIWGCSGKLICTTAVPWN) пептиды gp41 были выбраны из базы данных последовательности Los-Alamos HIV-1 (http://hiv.lanl.gov) и были синтезированы из Sigma Genosys, США. Пептиды были очищены методом ВЭЖХ до чистоты> 95% (на основе информации, предоставленной компанией). Слитый белок V3-холеры-токсина B (CTB) (V3C-CTB) и CTB дикого типа (WT-CTB), используемый для скрининга культур антител, любезно предоставил профессор Сьюзан Золла Пазнер из Школы медицины Нью-Йоркского университета.

Связывающую активность mAb против V3 против белков gp120 и пептидов (включая перекрывающиеся V3 пептиды) тестировали с помощью иммуноферментного анализа с использованием фермента (ELISA), как описано [18]. Вкратце, планшеты ELISA покрывали в течение ночи белком или пептидом со скоростью 1,0 мкг / мл, блокировали 2% бычьим сывороточным альбумином (BSA) в PBS и затем инкубировали с mAb в концентрации от 10 до 0,00003 мкг / мл (12 разведений) , Связанные mAb детектировали путем инкубации с конъюгированным с щелочной фосфатазой козьим античеловеческим IgG (γ-специфическим) (SouthernBiotech, Birmingham, AL) с последующим добавлением субстрата для развития цвета, и планшеты считывали при 405 нм. Относительные аффинности mAb определяли путем измерения концентрации mAb, необходимой для максимального связывания 50% (Max50), определяемого, когда кривая связывания достигла уровня насыщения, как описано [70].

Связывание mAb с интактными вирионами определяли с помощью анализа захвата, как описано выше [71]. Вкратце, 96-луночный планшет покрывали в течение ночи при 4 ° C козьим анти-человеческим иммуноглобулином G (IgG) Fc Abs (Sigma) при 4,0 мкг / мл, а затем анти-V3 человеческие mAb при насыщающем уровне 10 мкг / мл добавляли в течение 1,5 ч инкубации при 37 ° С. Пластину блокировали 0,5% BSA в забуференном фосфатом физиологическом растворе (PBS), содержащем 10% сыворотки коз и 10 мкг человеческого IgG / мл. Добавляли супернатант культуры, содержащий псевдотипные вирусы (Du156.12 и JRFL) при концентрации p24 25 нг / мл, и добавляли двухкратно разбавленный первичный изолят (SF162) с начальной концентрацией p24 / мл 50 нг. Планшет инкубировали в течение ночи при комнатной температуре. Вирусы, захваченные иммобилизованными mAb, лизировали 1% Triton-X в PBS. Между каждой стадией анализа планшет промывали PBS, содержащим 0,05% Tween 20, pH 7,4. P24 в вирусном лизате количественно определяли с использованием коммерческого ELISA. Анти-V3 Ab 447-52D и SF162, вирус подтипа В, который, как известно, чувствителен к большинству анти-V3 Abs, использовали в качестве контроля анализа, в то время как человеческий mAb, 1418, использовался как отрицательный контроль.

Одиннадцать ВИЧ-1 подтипов вирусов A, B и C, включая пять первичных изолятов (MW965, DJ263, SF162, JR-CSF и 92RW009) и шесть псевдотипированных вирусов (ВИЧ-001428, ZM109F.PB4, ZM233M.PB6, Du156.12, JRFL и RHPA4259.7). Все первичные вирусы и клонированные клоны были получены из NIH, ARRRP. Изоляты ВИЧ-1 были расширены только одним циклом роста фитогемагглютинина (PHA) и интерлейкина-2 (IL-2) -тимулированных РВМС, как описано ранее [45], чтобы избежать изменений в env-последовательностях из-за множественных раундов экспансии. Псевдотипированные вирусы продуцировали путем совместной трансфекции плазмиды экспрессии en / env и env-дефицитного белкового вектора ВИЧ-1 (pSG3ΔEnv) в экспоненциальное разделение 293 Т-клеток (АТСС, каталог № 11268), в 6-луночных планшетах для культивирования ткани (Corning Inc) с использованием метода фосфата кальция (Promega Inc). Псевдовирус, содержащие культуральные супернатанты, собирали через 48 часов после фильтрования трансфекцией (размер пор 0,45 мкм) и хранили при -80 ° С в аликвотах по 1 мл. 50% -ную инфекционную дозу культуры тканей (TCID50) определяли в клетках TZM-bl.

Нейтрализацию вирусов анти-V3 mAb измеряли как снижение экспрессии гена люциферазы после одного раунда инфицирования клеток JC53bl-13, также известных как клетки TZM-bl (NIH, ARRRP, каталог № 8129), с вирусами [ 72,73]. Вкратце, 200 TCID50 псевдовируса предварительно инкубировали в течение 1 часа при 37 o C, 5% CO2 в 96-луночных планшетах с плоским дном, с серийными разведениями mAb, начиная с 30 мкг / мл. Свежие трипсинизированные клетки TZM-bl (10000 клеток в 100 мкл среды для роста, содержащей DEAE-декстран и ингибитор инданавира протеазы (только в случае первичных изолятов), добавляли в каждую лунку смесей mAb / virus в дубликатах. Один набор контрольных лунок (контроль над вирусом) и еще один набор принимаемых клеток (контроль фонового изображения). После 48 часов инкубации при 37 ° С 5% CO2, активность люциферазы измеряли с использованием системы анализа люциферазы Bright-Glo (Promega Inc. ). Была определена 50-процентная ингибирующая концентрация mAb (IC50), при которой относительные единицы люминесценции (RLU) были уменьшены на 50% по сравнению с контрольными лунками.

Авторы заявляют, что у них нет конкурирующих интересов.

РА и КЛ разработали исследование, провели анализ данных и составили рукопись. RP и SS помогли в разработке дизайна. MB, AB и NW завербовали всех инфицированных ВИЧ-1 пациентов. RA проводила большинство экспериментов. RK, AN и PK помогли в амплификации плазмиды для генерации псевдотипа-вируса, определения последовательности гена последовательности иммуноглобулина и экспериментов по клонированию разбавления соответственно. Все авторы читали и одобрили окончательный вариант рукописи.

Таблица S1. Демографические и клинические данные из 33 ВИЧ-1 инфицированных наивных пациентов, завербованных для производства моноклональных антител человека.

Нажмите здесь для файла

Мы глубоко благодарим всех участников исследования. Мы признаем профессора Мирослава К. Горни профессора Сьюзан Золла Пазнер и доктора Гонконга из школы медицины Нью-Йоркского университета за их постоянную техническую консультацию и поддержку, а также за обеспечение использования слитого белка V3-холеры токсина B (V3C-CTB) в скрининге антител. Мы также хотели бы поблагодарить Констанцию ​​Уильямс за ее обширную техническую поддержку на протяжении всей работы. Поддержка, выдвинутая доктором Суманом Лаалом, высоко признана. Мы благодарим DBT (BT / PR 10511 / MED / 29/66/2008) и ICMR (61/7/2008-BMS) за финансирование этой работы. Признается стипендия Fogarty AIDS International Training & Research Program (AITRP) (США), стипендия JRF / SRF, предоставленная Индийским советом медицинских исследований (ICMR) Райешу Андраби.

Комментариев нет.

Добавить комментарий

Ваш e-mail не будет опубликован. Обязательные поля помечены *